Hmdb loader
Identification
HMDB Protein ID HMDBP11828
Secondary Accession Numbers None
Name Alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B
Synonyms
  1. Alpha-mannoside beta-1,6-N-acetylglucosaminyltransferase B
  2. GlcNAc-T Vb
  3. Mannoside acetylglucosaminyltransferase 5B
  4. N-acetylglucosaminyl-transferase Vb
  5. N-acetylglucosaminyltransferase IX
  6. GNT-Vb
  7. hGnTVb
  8. GNT-IX
Gene Name MGAT5B
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Glycosyltransferase that acts on alpha-linked mannose of N-glycans and O-mannosyl glycans. Catalyzes the transfer of N-acetylglucosamine (GlcNAc) to the beta 1-6 linkage of the mannose residue of GlcNAcbeta1,2-Manalpha on both the alpha1,3- and alpha1,6-linked mannose arms in the core structure of N-glycan. Also acts on the GlcNAcbeta1,2-Manalpha1-Ser/Thr moiety, forming a 2,6-branched structure in brain O-mannosyl glycan. Plays an active role in modulating integrin and laminin-dependent adhesion and migration of neuronal cells via its activity in the O-mannosyl glycan pathway.
Pathways
  • N-Glycan biosynthesis
  • Other types of O-glycan biosynthesis
  • protein glycosylation
Reactions
Uridine diphosphate-N-acetylglucosamine + 6-(2-(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R → Uridine 5'-diphosphate + 6-(2,6-bis(N-acetyl-beta-D-glucosaminyl)-alpha-D-mannosyl)-beta-D-mannosyl-R details
UDP-N-acetyl-D-glucosamine + → UDP + details
UDP-N-acetyl-D-glucosamine + → UDP + details
UDP-N-acetyl-D-glucosamine + → UDP + details
UDP-N-acetyl-D-glucosamine + → UDP + details
UDP-N-acetyl-D-glucosamine + → UDP + details
UDP-N-acetyl-D-glucosamine + → UDP + details
GO Classification
Biological Process
protein N-linked glycosylation
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
metal ion binding
alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 89534.545
Theoretical pI 8.359
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|312596905|ref|NP_001186101.1| alpha-1,6-mannosylglycoprotein 6-beta-N-acetylglucosaminyltransferase B isoform 3 [Homo sapiens]
MITVNPDGKIMVRRCLVTLRPFRLFVLGIGFFTLCFLMTSLGGQFSARRLGDSPFTIRTE
VMGGPESRGV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q3V5L5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:24140
References
General References Not Available