Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11830
Secondary Accession Numbers None
Name tRNA dimethylallyltransferase, mitochondrial
Synonyms
  1. Isopentenyl-diphosphate:tRNA isopentenyltransferase
  2. hGRO1
  3. tRNA isopentenyltransferase
  4. IPP transferase
  5. IPPT
  6. IPTase
Gene Name TRIT1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the transfer of a dimethylallyl group onto the adenine at position 37 of both cytosolic and mitochondrial tRNAs, leading to the formation of N6-(dimethylallyl)adenosine (i(6)A).
Pathways Not Available
Reactions
Dimethylallylpyrophosphate + tRNA → Pyrophosphate + tRNA containing 6-dimethylallyladenosine details
Dimethylallylpyrophosphate + tRNA → Pyrophosphate + tRNA containing 6-isopentenyladenosine details
GO Classification
Biological Process
tRNA processing
Cellular Component
mitochondrion
Molecular Function
tRNA dimethylallyltransferase activity
metal ion binding
ATP binding
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p34.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 52724.84
Theoretical pI 8.201
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|31581534|ref|NP_060116.2| tRNA dimethylallyltransferase, mitochondrial precursor [Homo sapiens]
MASVAAARAVPVGSGLRGLQRTLPLVVILGATGTGKSTLALQLGQRLGGEIVSADSMQVY
EGLDIITNKV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H3H1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20286
References
General References Not Available