You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11832
Secondary Accession Numbers None
Name Putative helicase MOV-10
Synonyms
  1. Moloney leukemia virus 10 protein
Gene Name MOV10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable RNA helicase. Required for RNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Also required for RNA-directed transcription and replication of the human hepatitis delta virus (HDV). Interacts with small capped HDV RNAs derived from genomic hairpin structures that mark the initiation sites of RNA-dependent HDV RNA transcription.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
mRNA cleavage involved in gene silencing by miRNA
Notch signaling pathway
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
cytosol
cytoplasmic mRNA processing body
Molecular Function
ATP binding
RNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 113670.24
Theoretical pI 8.815
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|194272168|ref|NP_001123551.1| putative helicase MOV-10 [Homo sapiens]
MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYG
MKIANLAYVT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9HCE1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7200
References
General References Not Available