Showing Protein Putative helicase MOV-10 (HMDBP11832)
| Identification | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11832 | ||||||||||||
| Secondary Accession Numbers | None | ||||||||||||
| Name | Putative helicase MOV-10 | ||||||||||||
| Synonyms |
|
||||||||||||
| Gene Name | MOV10 | ||||||||||||
| Protein Type | Unknown | ||||||||||||
| Biological Properties | |||||||||||||
| General Function | Not Available | ||||||||||||
| Specific Function | Probable RNA helicase. Required for RNA-mediated gene silencing by the RNA-induced silencing complex (RISC). Required for both miRNA-mediated translational repression and miRNA-mediated cleavage of complementary mRNAs by RISC. Also required for RNA-directed transcription and replication of the human hepatitis delta virus (HDV). Interacts with small capped HDV RNAs derived from genomic hairpin structures that mark the initiation sites of RNA-dependent HDV RNA transcription. | ||||||||||||
| Pathways | Not Available | ||||||||||||
| Reactions |
|
||||||||||||
| GO Classification |
|
||||||||||||
| Cellular Location | Not Available | ||||||||||||
| Gene Properties | |||||||||||||
| Chromosome Location | 1 | ||||||||||||
| Locus | 1p13.2 | ||||||||||||
| SNPs | Not Available | ||||||||||||
| Gene Sequence | Not Available | ||||||||||||
| Protein Properties | |||||||||||||
| Number of Residues | Not Available | ||||||||||||
| Molecular Weight | 113670.24 | ||||||||||||
| Theoretical pI | 8.815 | ||||||||||||
| Pfam Domain Function | Not Available | ||||||||||||
| Signals | Not Available | ||||||||||||
| Transmembrane Regions | Not Available | ||||||||||||
| Protein Sequence |
>>gi|194272168|ref|NP_001123551.1| putative helicase MOV-10 [Homo sapiens] MPSKFSCRQLREAGQCFESFLVVRGLDMETDRERLRTIYNRDFKISFGTPAPGFSSMLYG MKIANLAYVT |
||||||||||||
| External Links | |||||||||||||
| GenBank ID Protein | Not Available | ||||||||||||
| UniProtKB/Swiss-Prot ID | Q9HCE1 | ||||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||
| PDB IDs | Not Available | ||||||||||||
| GenBank Gene ID | Not Available | ||||||||||||
| GeneCard ID | Not Available | ||||||||||||
| GenAtlas ID | Not Available | ||||||||||||
| HGNC ID | HGNC:7200 | ||||||||||||
| References | |||||||||||||
| General References | Not Available | ||||||||||||