You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11835
Secondary Accession Numbers None
Name Mitochondrial pyruvate carrier 2
Synonyms
  1. Brain protein 44
Gene Name MPC2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mediates the uptake of pyruvate into mitochondria.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
transport
Cellular Component
mitochondrion
integral to membrane
mitochondrial inner membrane
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 14278.74
Theoretical pI 10.435
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|219521872|ref|NP_001137146.1| mitochondrial pyruvate carrier 2 [Homo sapiens]
MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKWGLVCAGLADM
ARPAEKLSTA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95563
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:24515
References
General References Not Available