Hmdb loader
Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11841
Secondary Accession Numbers None
Name Methylthioribulose-1-phosphate dehydratase
Synonyms
  1. MTRu-1-P dehydratase
  2. APAF1-interacting protein
  3. hAPIP
Gene Name APIP
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Catalyzes the dehydration of methylthioribulose-1-phosphate (MTRu-1-P) into 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P). Functions in the methionine salvage pathway, which plays a key role in cancer, apoptosis, microbial proliferation and inflammation. May inhibit the CASP1-related inflammatory response (pyroptosis), the CASP9-dependent apoptotic pathway and the cytochrome c-dependent and APAF1-mediated cell death.
Pathways
  • Cysteine and methionine metabolism
  • L-methionine biosynthesis via salvage pathway
Reactions
5-Methylthioribulose 1-phosphate → 5-(Methylthio)-2,3-dioxopentyl phosphate + Water details
GO Classification
Biological Process
apoptotic process
negative regulation of apoptotic process
L-methionine salvage from methylthioadenosine
polyamine metabolic process
Cellular Component
cytosol
Molecular Function
metal ion binding
methylthioribulose 1-phosphate dehydratase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11p13
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 27125.065
Theoretical pI 7.123
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|166235186|ref|NP_057041.2| methylthioribulose-1-phosphate dehydratase [Homo sapiens]
MSGCDAREGDCCSRRCGAQDKEHPRYLIPELCKQFYHLGWVTGTGGGISLKHGDEIYIAP
SGVQKERIQP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96GX9
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17581
References
General References Not Available