Showing Protein Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 (HMDBP11842)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11842 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | FTSJD2 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m(7)GpppG-capped mRNA to produce m(7)GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. May be involved in the interferon response pathway. | ||||||||
| Pathways | Not Available | ||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 6 | ||||||||
| Locus | 6p21.2 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 95319.96 | ||||||||
| Theoretical pI | 7.055 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|24307983|ref|NP_055865.1| cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Homo sapiens] MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGK QHSSDSFDDA |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q8N1G2 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:21077 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||