| Identification |
|---|
| HMDB Protein ID
| HMDBP11842 |
| Secondary Accession Numbers
| None |
| Name
| Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 |
| Synonyms
|
- Cap1 2'O-ribose methyltransferase 1
- FtsJ methyltransferase domain-containing protein 2
- Interferon-stimulated gene 95 kDa protein
- MTr1
- hMTr1
- ISG95
|
| Gene Name
| FTSJD2 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| S-adenosyl-L-methionine-dependent methyltransferase that mediates mRNA cap1 2'-O-ribose methylation to the 5'-cap structure of mRNAs. Methylates the ribose of the first nucleotide of a m(7)GpppG-capped mRNA to produce m(7)GpppNmp (cap1). Cap1 modification is linked to higher levels of translation. May be involved in the interferon response pathway.
|
| Pathways
|
Not Available
|
| Reactions
|
| S-Adenosylmethionine + m(7)G(5')pppR-RNA → S-Adenosylhomocysteine + m(7)G(5')pppRm-RNA |
details
|
|
| GO Classification
|
| Biological Process |
| 7-methylguanosine mRNA capping |
| Cellular Component |
| cytoplasm |
| nucleus |
| Molecular Function |
| nucleic acid binding |
| mRNA (nucleoside-2'-O-)-methyltransferase activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 6 |
| Locus
| 6p21.2 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 95319.96 |
| Theoretical pI
| 7.055 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|24307983|ref|NP_055865.1| cap-specific mRNA (nucleoside-2'-O-)-methyltransferase 1 [Homo sapiens]
MKRRTDPECTAPIKKQKKRVAELALSLSSTSDDEPPSSVSHGAKASTTSLSGSDSETEGK
QHSSDSFDDA
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q8N1G2 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:21077 |
| References |
|---|
| General References
| Not Available |
