You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11843
Secondary Accession Numbers None
Name N-alpha-acetyltransferase 10
Synonyms
  1. N-terminal acetyltransferase complex ARD1 subunit homolog A
  2. NatA catalytic subunit
Gene Name NAA10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration.
Pathways Not Available
Reactions
Acetyl-CoA + peptide → N(alpha)-acetylpeptide + Coenzyme A details
GO Classification
Biological Process
DNA packaging
N-terminal protein amino acid acetylation
internal protein amino acid acetylation
Cellular Component
cytoplasm
nucleus
Molecular Function
N-acetyltransferase activity
peptide alpha-N-acetyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location X
Locus Xq28
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 26458.27
Theoretical pI 5.643
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|10835057|ref|NP_003482.1| N-alpha-acetyltransferase 10 isoform 1 [Homo sapiens]
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P41227
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18704
References
General References Not Available