Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11848
Secondary Accession Numbers None
Name NAD kinase domain-containing protein 1, mitochondrial
Synonyms Not Available
Gene Name NADKD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mitochondrial NAD(+) kinase that phosphorylates NAD(+) to yield NADP(+). Can use both ATP or inorganic polyphosphate as the phosphoryl donor. Also has weak NADH kinase activity in vitro; however NADH kinase activity is much weaker than the NAD(+) kinase activity and may not be relevant in vivo.
Pathways Not Available
Reactions
Adenosine triphosphate + NAD → ADP + NADP details
GO Classification
Biological Process
NADP biosynthetic process
NAD metabolic process
Cellular Component
mitochondrion
Molecular Function
NAD+ kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p13.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49432.465
Theoretical pI 8.171
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|146134341|ref|NP_001078880.1| NAD kinase domain-containing protein 1, mitochondrial isoform 1 [Homo sapiens]
MTCYRGFLLGSCCRVAGGRAAALRGPGAGGPAARPRLGGDGGGRRHLGQGQPRELAGCGS
RADGGFRPSR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q4G0N4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:26404
References
General References Not Available