Showing Protein Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 (HMDBP11853)
Identification | ||||||||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11853 | |||||||||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||||||||
Name | Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 | |||||||||||||||||||||
Synonyms |
|
|||||||||||||||||||||
Gene Name | NDST1 | |||||||||||||||||||||
Protein Type | Unknown | |||||||||||||||||||||
Biological Properties | ||||||||||||||||||||||
General Function | Not Available | |||||||||||||||||||||
Specific Function | Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a role in determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence is absolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands, thereby playing a role in inflammatory response. | |||||||||||||||||||||
Pathways |
|
|||||||||||||||||||||
Reactions |
|
|||||||||||||||||||||
GO Classification |
|
|||||||||||||||||||||
Cellular Location | Not Available | |||||||||||||||||||||
Gene Properties | ||||||||||||||||||||||
Chromosome Location | 5 | |||||||||||||||||||||
Locus | 5q33.1 | |||||||||||||||||||||
SNPs | Not Available | |||||||||||||||||||||
Gene Sequence | Not Available | |||||||||||||||||||||
Protein Properties | ||||||||||||||||||||||
Number of Residues | Not Available | |||||||||||||||||||||
Molecular Weight | 100867.015 | |||||||||||||||||||||
Theoretical pI | 7.978 | |||||||||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||||||||
Signals | Not Available | |||||||||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||||||||
Protein Sequence |
>>gi|4505351|ref|NP_001534.1| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1 [Homo sapiens] MPALACLRRLCRHVSPQAVLFLLFIFCLFSVFISAYYLYGWKRGLEPSADAPEPDCGDPP PVAPSRLLPL |
|||||||||||||||||||||
External Links | ||||||||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||||||||
UniProtKB/Swiss-Prot ID | P52848 | |||||||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||||||||
PDB IDs | ||||||||||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||||||||
GeneCard ID | Not Available | |||||||||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||||||||
HGNC ID | HGNC:7680 | |||||||||||||||||||||
References | ||||||||||||||||||||||
General References | Not Available |