Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11855
Secondary Accession Numbers None
Name Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
Synonyms
  1. Glucosaminyl N-deacetylase/N-sulfotransferase 3
  2. N-heparan sulfate sulfotransferase 3
  3. NDST-3
  4. hNDST-3
  5. N-HSST 3
Gene Name NDST3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has high deacetylase activity but low sulfotransferase activity.
Pathways
  • Glycosaminoglycan biosynthesis - heparan sulfate / heparin
  • heparan sulfate biosynthesis
  • heparin biosynthesis
Reactions
Phosphoadenosine phosphosulfate + [heparan sulfate]-glucosamine → Adenosine 3',5'-diphosphate + [heparan sulfate]-N-sulfoglucosamine details
GO Classification
Biological Process
heparan sulfate proteoglycan biosynthetic process
heparin biosynthetic process
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
deacetylase activity
[heparan sulfate]-glucosamine N-sulfotransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q26
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 100901.23
Theoretical pI 8.067
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4758766|ref|NP_004775.1| bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3 [Homo sapiens]
MSFIMKLHRHFQRTVILLATFCMVSIIISAYYLYSGYKQENELSETASEVDCGDLQHLPY
QLMEVKAMKL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O95803
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:7682
References
General References Not Available