Hmdb loader
Identification
HMDB Protein ID HMDBP11860
Secondary Accession Numbers None
Name Magnesium transporter NIPA3
Synonyms
  1. NIPA-like protein 1
  2. Non-imprinted in Prader-Willi/Angelman syndrome region protein 3
Gene Name NIPAL1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to membrane
Molecular Function
magnesium ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4p12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 44637.595
Theoretical pI 5.999
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|46409302|ref|NP_997213.1| magnesium transporter NIPA3 [Homo sapiens]
MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISA
NVENKYSLYV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6NVV3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:27194
References
General References Not Available