Showing Protein Magnesium transporter NIPA3 (HMDBP11860)
| Identification | |||||
|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11860 | ||||
| Secondary Accession Numbers | None | ||||
| Name | Magnesium transporter NIPA3 | ||||
| Synonyms |
|
||||
| Gene Name | NIPAL1 | ||||
| Protein Type | Unknown | ||||
| Biological Properties | |||||
| General Function | Not Available | ||||
| Specific Function | Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Fe(2+), Sr(2+), Ba(2+), Mn(2+), Cu(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity). | ||||
| Pathways | Not Available | ||||
| Reactions | Not Available | ||||
| GO Classification |
|
||||
| Cellular Location | Not Available | ||||
| Gene Properties | |||||
| Chromosome Location | 4 | ||||
| Locus | 4p12 | ||||
| SNPs | Not Available | ||||
| Gene Sequence | Not Available | ||||
| Protein Properties | |||||
| Number of Residues | Not Available | ||||
| Molecular Weight | 44637.595 | ||||
| Theoretical pI | 5.999 | ||||
| Pfam Domain Function | Not Available | ||||
| Signals | Not Available | ||||
| Transmembrane Regions | Not Available | ||||
| Protein Sequence |
>>gi|46409302|ref|NP_997213.1| magnesium transporter NIPA3 [Homo sapiens] MGAQVRLPPGEPCREGYVLSLVCPNSSQAWCEITNVSQLLASPVLYTDLNYSINNLSISA NVENKYSLYV |
||||
| External Links | |||||
| GenBank ID Protein | Not Available | ||||
| UniProtKB/Swiss-Prot ID | Q6NVV3 | ||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
| PDB IDs | Not Available | ||||
| GenBank Gene ID | Not Available | ||||
| GeneCard ID | Not Available | ||||
| GenAtlas ID | Not Available | ||||
| HGNC ID | HGNC:27194 | ||||
| References | |||||
| General References | Not Available | ||||