Showing Protein Magnesium transporter NIPA4 (HMDBP11861)
| Identification | |||||
|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11861 | ||||
| Secondary Accession Numbers | None | ||||
| Name | Magnesium transporter NIPA4 | ||||
| Synonyms |
|
||||
| Gene Name | NIPAL4 | ||||
| Protein Type | Unknown | ||||
| Biological Properties | |||||
| General Function | Not Available | ||||
| Specific Function | Acts as a Mg(2+) transporter. Can also transport other divalent cations such as Ba(2+), Mn(2+), Sr(2+) and Co(2+) but to a much less extent than Mg(2+) (By similarity). May be a receptor for ligands (trioxilins A3 and B3) from the hepoxilin pathway. | ||||
| Pathways | Not Available | ||||
| Reactions | Not Available | ||||
| GO Classification |
|
||||
| Cellular Location | Not Available | ||||
| Gene Properties | |||||
| Chromosome Location | 5 | ||||
| Locus | 5q33.3 | ||||
| SNPs | Not Available | ||||
| Gene Sequence | Not Available | ||||
| Protein Properties | |||||
| Number of Residues | Not Available | ||||
| Molecular Weight | 50057.055 | ||||
| Theoretical pI | 7.425 | ||||
| Pfam Domain Function | Not Available | ||||
| Signals | Not Available | ||||
| Transmembrane Regions | Not Available | ||||
| Protein Sequence |
>>gi|149944536|ref|NP_001092757.1| magnesium transporter NIPA4 isoform 1 [Homo sapiens] MPGDSSPGTLPLWDASLSPPLGPDPGGFSRASHAGDKSRPPAPELGSPGAVRPRVGSCAP GPMELRVSNT |
||||
| External Links | |||||
| GenBank ID Protein | Not Available | ||||
| UniProtKB/Swiss-Prot ID | Q0D2K0 | ||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||
| PDB IDs | Not Available | ||||
| GenBank Gene ID | Not Available | ||||
| GeneCard ID | Not Available | ||||
| GenAtlas ID | Not Available | ||||
| HGNC ID | HGNC:28018 | ||||
| References | |||||
| General References | Not Available | ||||