You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Nitrogen permease regulator 2-like protein (HMDBP11865)
Identification | |||||||
---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11865 | ||||||
Secondary Accession Numbers | None | ||||||
Name | Nitrogen permease regulator 2-like protein | ||||||
Synonyms |
|
||||||
Gene Name | NPRL2 | ||||||
Protein Type | Unknown | ||||||
Biological Properties | |||||||
General Function | Not Available | ||||||
Specific Function | Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs. | ||||||
Pathways | Not Available | ||||||
Reactions | Not Available | ||||||
GO Classification |
|
||||||
Cellular Location | Not Available | ||||||
Gene Properties | |||||||
Chromosome Location | 3 | ||||||
Locus | 3p21.3 | ||||||
SNPs | Not Available | ||||||
Gene Sequence | Not Available | ||||||
Protein Properties | |||||||
Number of Residues | Not Available | ||||||
Molecular Weight | 43658.085 | ||||||
Theoretical pI | 6.528 | ||||||
Pfam Domain Function |
|
||||||
Signals | Not Available | ||||||
Transmembrane Regions | Not Available | ||||||
Protein Sequence |
>>gi|50592992|ref|NP_006536.3| nitrogen permease regulator 2-like protein [Homo sapiens] MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM EKKLIGCPVC |
||||||
External Links | |||||||
GenBank ID Protein | Not Available | ||||||
UniProtKB/Swiss-Prot ID | Q8WTW4 | ||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||
PDB IDs | Not Available | ||||||
GenBank Gene ID | Not Available | ||||||
GeneCard ID | Not Available | ||||||
GenAtlas ID | Not Available | ||||||
HGNC ID | HGNC:24969 | ||||||
References | |||||||
General References | Not Available |