Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11865
Secondary Accession Numbers None
Name Nitrogen permease regulator 2-like protein
Synonyms
  1. NPR2-like protein
  2. Gene 21 protein
  3. Tumor suppressor candidate 4
  4. G21 protein
Gene Name NPRL2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Suppresses Src-dependent tyrosine phosphorylation and activation of PDPK1 and its downstream signaling. Down-regulates PDPK1 kinase activity by interfering with tyrosine phosphorylation at the Tyr-9 Tyr-373 and Tyr-376 residues. May act as a tumor suppressor. Suppresses cell growth and enhanced sensitivity to various anticancer drugs.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
negative regulation of kinase activity
Cellular Component
cytoplasm
Molecular Function
protein kinase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3p21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 43658.085
Theoretical pI 6.528
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|50592992|ref|NP_006536.3| nitrogen permease regulator 2-like protein [Homo sapiens]
MGSGCRIECIFFSEFHPTLGPKITYQVPEDFISRELFDTVQVYIITKPELQNKLITVTAM
EKKLIGCPVC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8WTW4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:24969
References
General References Not Available