Showing Protein Geranylgeranyl transferase type-2 subunit alpha (HMDBP11878)
Identification | |||||||||
---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11878 | ||||||||
Secondary Accession Numbers | None | ||||||||
Name | Geranylgeranyl transferase type-2 subunit alpha | ||||||||
Synonyms |
|
||||||||
Gene Name | RABGGTA | ||||||||
Protein Type | Unknown | ||||||||
Biological Properties | |||||||||
General Function | Not Available | ||||||||
Specific Function | Catalyzes the transfer of a geranyl-geranyl moiety from geranyl-geranyl pyrophosphate to both cysteines in Rab proteins with an -XXCC, -XCXC and -CCXX C-terminal, such as RAB1A, RAB3A and RAB5A respectively. | ||||||||
Pathways | Not Available | ||||||||
Reactions |
|
||||||||
GO Classification |
|
||||||||
Cellular Location | Not Available | ||||||||
Gene Properties | |||||||||
Chromosome Location | 14 | ||||||||
Locus | 14q11.2 | ||||||||
SNPs | Not Available | ||||||||
Gene Sequence | Not Available | ||||||||
Protein Properties | |||||||||
Number of Residues | Not Available | ||||||||
Molecular Weight | 65071.06 | ||||||||
Theoretical pI | 5.667 | ||||||||
Pfam Domain Function | Not Available | ||||||||
Signals | Not Available | ||||||||
Transmembrane Regions | Not Available | ||||||||
Protein Sequence |
>>gi|53828918|ref|NP_004572.3| geranylgeranyl transferase type-2 subunit alpha [Homo sapiens] MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANP DFATLWNCRR |
||||||||
External Links | |||||||||
GenBank ID Protein | Not Available | ||||||||
UniProtKB/Swiss-Prot ID | Q92696 | ||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
PDB IDs | Not Available | ||||||||
GenBank Gene ID | Not Available | ||||||||
GeneCard ID | Not Available | ||||||||
GenAtlas ID | Not Available | ||||||||
HGNC ID | HGNC:9795 | ||||||||
References | |||||||||
General References | Not Available |