Showing Protein Protein phosphatase methylesterase 1 (HMDBP11895)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11895 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Protein phosphatase methylesterase 1 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | PPME1 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Demethylates proteins that have been reversibly carboxymethylated. Demethylates PPP2CB (in vitro) and PPP2CA. Binding to PPP2CA displaces the manganese ion and inactivates the enzyme. | ||||||||
| Pathways | Not Available | ||||||||
| Reactions |
|
||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 11 | ||||||||
| Locus | 11q13.4 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 43869.905 | ||||||||
| Theoretical pI | 5.845 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|409971401|ref|NP_001258522.1| protein phosphatase methylesterase 1 isoform b [Homo sapiens] MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVEN ETGKDTFRVY |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q9Y570 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | |||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:30178 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||