Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11895
Secondary Accession Numbers None
Name Protein phosphatase methylesterase 1
Synonyms
  1. PME-1
Gene Name PPME1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Demethylates proteins that have been reversibly carboxymethylated. Demethylates PPP2CB (in vitro) and PPP2CA. Binding to PPP2CA displaces the manganese ion and inactivates the enzyme.
Pathways Not Available
Reactions
[Phosphatase 2A protein]-leucine methyl ester + Water → [phosphatase 2A protein]-leucine + Methanol details
GO Classification
Biological Process
protein demethylation
Molecular Function
protein phosphatase inhibitor activity
protein phosphatase type 2A regulator activity
carboxylesterase activity
protein C-terminal methylesterase activity
protein phosphatase 2A binding
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11q13.4
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 43869.905
Theoretical pI 5.845
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|409971401|ref|NP_001258522.1| protein phosphatase methylesterase 1 isoform b [Homo sapiens]
MSALEKSMHLGRLPSRPPLPGSGGSQSGAKMRMGPGRKRDFSPVPWSQYFESMEDVEVEN
ETGKDTFRVY
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9Y570
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30178
References
General References Not Available