Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11897
Secondary Accession Numbers None
Name Probable histone-lysine N-methyltransferase PRDM7
Synonyms
  1. PR domain zinc finger protein 7
  2. PR domain-containing protein 7
Gene Name PRDM7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable histone methyltransferase (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
GO Classification
Biological Process
histone lysine methylation
regulation of transcription, DNA-dependent
Cellular Component
chromosome
nucleus
Molecular Function
nucleic acid binding
histone-lysine N-methyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q24.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 55777.045
Theoretical pI 7.879
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|148271100|ref|NP_001091643.1| probable histone-lysine N-methyltransferase PRDM7 isoform 1 [Homo sapiens]
MSPERSQEESPEGDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKMNYNA
LITVGLRATR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQW5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9351
References
General References Not Available