You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11898
Secondary Accession Numbers None
Name Histone-lysine N-methyltransferase PRDM9
Synonyms
  1. PR domain zinc finger protein 9
  2. PR domain-containing protein 9
Gene Name PRDM9
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Histone methyltransferase that specifically trimethylates 'Lys-4' of histone H3 during meiotic prophase and is essential for proper meiotic progression. Does not have the ability to mono- and dimethylate 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. Plays a central role in the transcriptional activation of genes during early meiotic prophase (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
GO Classification
Biological Process
histone lysine methylation
meiotic gene conversion
positive regulation of reciprocal meiotic recombination
regulation of transcription, DNA-dependent
transcription, DNA-dependent
Cellular Component
chromosome
nucleoplasm
Molecular Function
nucleic acid binding
histone-lysine N-methyltransferase activity
metal ion binding
zinc ion binding
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5p14
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 103375.975
Theoretical pI 9.191
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|147905620|ref|NP_064612.2| histone-lysine N-methyltransferase PRDM9 [Homo sapiens]
MSPEKSQEESPEEDTERTERKPMVKDAFKDISIYFTKEEWAEMGDWEKTRYRNVKRNYNA
LITIGLRATR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NQV7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:13994
References
General References Not Available