You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11901
Secondary Accession Numbers None
Name Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16
Synonyms
  1. ATP-dependent RNA helicase DHX38
  2. DEAH box protein 38
Gene Name DHX38
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
Pathways
  • Spliceosome
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
mRNA 3'-end processing
mRNA export from nucleus
mRNA splicing, via spliceosome
termination of RNA polymerase II transcription
Cellular Component
nucleoplasm
catalytic step 2 spliceosome
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 140501.58
Theoretical pI 6.538
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|17999539|ref|NP_054722.2| pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [Homo sapiens]
MGDTSEDASIHRLEGTDLDCQVGGLICKSKSAASEQHVFKAPAPRPSLLGLDLLASLKRR
EREEKDDGED
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92620
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17211
References
General References Not Available