Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11902
Secondary Accession Numbers None
Name Tyrosine-protein phosphatase non-receptor type 20
Synonyms
  1. hPTPN20
Gene Name PTPN20A
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Tyrosine-protein phosphatase targeted to sites of actin polymerization in response of varied extracellular stimuli. Has tyrosine phosphatase activity towards various tyrosyl phosphorylated substrates.
Pathways Not Available
Reactions
Protein tyrosine phosphate + Water → protein tyrosine + Phosphate details
GO Classification
Biological Process
peptidyl-tyrosine dephosphorylation
Cellular Component
cytoplasm
nucleus
microtubule organizing center
microtubule
Molecular Function
protein tyrosine phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 10
Locus 10q11.22
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 48422.455
Theoretical pI 5.768
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|108802604|ref|NP_001035816.1| protein tyrosine phosphatase, non-receptor type 20 isoform 1 [Homo sapiens]
MSSPRDFRAEPVNDYEGNDSEAEDLNFRETLPSSSQENTPRSKVFENKVNSEKVKLSLRN
FPHNDYEDVF
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q4JDL3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:23423
References
General References Not Available