You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11906
Secondary Accession Numbers None
Name Epidermal retinol dehydrogenase 2
Synonyms
  1. EPHD-2
  2. RDH-E2
  3. Retinal short-chain dehydrogenase reductase 2
  4. Short-chain dehydrogenase/reductase family 16C member 5
  5. retSDR2
Gene Name SDR16C5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Oxidoreductase with strong preference for NAD. Active in both the oxidative and reductive directions. Oxidizes all-trans-retinol in all-trans-retinaldehyde. No activity was detected with 11-cis-retinol or 11-cis-retinaldehyde as substrates with either NAD(+)/NADH or NADP(+)/NADPH.
Pathways
  • Retinol metabolism
Reactions
All-trans-retinol-[cellular-retinol-binding-protein] + NAD → all-trans-retinal-[cellular-retinol-binding-protein] + NADH details
Vitamin A + NAD → Retinal + NADH + Hydrogen Ion details
GO Classification
Biological Process
retinol metabolic process
retinal metabolic process
detection of light stimulus involved in visual perception
keratinocyte proliferation
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
retinol dehydrogenase activity
nucleotide binding
Cellular Location Not Available
Gene Properties
Chromosome Location 8
Locus 8q12.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 34095.0
Theoretical pI 8.454
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|40807363|ref|NP_620419.2| epidermal retinol dehydrogenase 2 [Homo sapiens]
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLW
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8N3Y7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:30311
References
General References Not Available