Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11910
Secondary Accession Numbers None
Name DNA-directed RNA polymerase I subunit RPA43
Synonyms
  1. Twist neighbor protein
Gene Name TWISTNB
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase I which synthesizes ribosomal RNA precursors. Through its association with RRN3/TIF-IA may be involved in recruitment of Pol I to rDNA promoters.
Pathways
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
transcription, DNA-dependent
Cellular Component
microtubule cytoskeleton
nucleolus
Molecular Function
DNA-directed RNA polymerase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 7
Locus 7p21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 37432.025
Theoretical pI 6.976
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|50962817|ref|NP_001002926.1| DNA-directed RNA polymerase I subunit RPA43 [Homo sapiens]
MAAGCSEAPRPAAASDGSLVGQAGVLPCLELPTYAAACALVNSRYSCLVAGPHQRHIALS
PRYLNRKRTG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q3B726
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18027
References
General References Not Available