| Identification |
|---|
| HMDB Protein ID
| HMDBP11911 |
| Secondary Accession Numbers
| None |
| Name
| DNA-directed RNA polymerases I, II, and III subunit RPABC1 |
| Synonyms
|
- RNA polymerases I, II, and III subunit ABC1
- DNA-directed RNA polymerase II 23 kDa polypeptide
- DNA-directed RNA polymerase II subunit E
- RPB5 homolog
- XAP4
|
| Gene Name
| POLR2E |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2E/RPB5 is part of the lower jaw surrounding the central large cleft and thought to grab the incoming DNA template. Seems to be the major component in this process (By similarity).
|
| Pathways
|
- Cytosolic DNA-sensing pathway
- Epstein-Barr virus infection
- Huntington disease
- Purine metabolism
- Pyrimidine metabolism
- RNA polymerase
|
| Reactions
|
| Adenosine triphosphate + RNA → Pyrophosphate + RNA |
details
|
| Guanosine triphosphate + RNA → Pyrophosphate + RNA |
details
|
| Cytidine triphosphate + RNA → Pyrophosphate + RNA |
details
|
| Uridine triphosphate + RNA → Pyrophosphate + RNA |
details
|
|
| GO Classification
|
| Biological Process |
| termination of RNA polymerase III transcription |
| transcription elongation from RNA polymerase III promoter |
| transcription-coupled nucleotide-excision repair |
| 7-methylguanosine mRNA capping |
| mRNA splicing, via spliceosome |
| virus-host interaction |
| viral reproduction |
| protein phosphorylation |
| positive regulation of viral transcription |
| transcription elongation from RNA polymerase II promoter |
| transcription initiation from RNA polymerase II promoter |
| Cellular Component |
| DNA-directed RNA polymerase II, core complex |
| Molecular Function |
| DNA-directed RNA polymerase activity |
| DNA binding |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 19 |
| Locus
| 19p13.3 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 24611.175 |
| Theoretical pI
| 5.953 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|14589951|ref|NP_002686.2| DNA-directed RNA polymerases I, II, and III subunit RPABC1 [Homo sapiens]
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQFGDKPSEGRPRRTDLTV
LVAHNDDPTD
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| P19388 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:9192 |
| References |
|---|
| General References
| Not Available |
