Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11915
Secondary Accession Numbers None
Name DNA-directed RNA polymerases I, II, and III subunit RPABC5
Synonyms
  1. RNA polymerases I, II, and III subunit ABC5
  2. DNA-directed RNA polymerase III subunit L
  3. RNA polymerase II 7.6 kDa subunit
  4. RPB10 homolog
  5. RPB7.6
Gene Name POLR2L
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft (By similarity).
Pathways
  • Cytosolic DNA-sensing pathway
  • Epstein-Barr virus infection
  • Huntington disease
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
termination of RNA polymerase III transcription
transcription elongation from RNA polymerase III promoter
regulation of transcription from RNA polymerase I promoter
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
viral reproduction
protein phosphorylation
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
DNA-directed RNA polymerase II, core complex
Molecular Function
metal ion binding
zinc ion binding
DNA-directed RNA polymerase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 11
Locus 11p15
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 7645.02
Theoretical pI 7.771
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|10863925|ref|NP_066951.1| DNA-directed RNA polymerases I, II, and III subunit RPABC5 [Homo sapiens]
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P62875
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9199
References
General References Not Available