You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification |
HMDB Protein ID
| HMDBP11915 |
Secondary Accession Numbers
| None |
Name
| DNA-directed RNA polymerases I, II, and III subunit RPABC5 |
Synonyms
|
- RNA polymerases I, II, and III subunit ABC5
- DNA-directed RNA polymerase III subunit L
- RNA polymerase II 7.6 kDa subunit
- RPB10 homolog
- RPB7.6
|
Gene Name
| POLR2L |
Protein Type
| Unknown |
Biological Properties |
General Function
| Not Available |
Specific Function
| DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and a small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2L/RBP10 is part of the core element with the central large cleft (By similarity).
|
Pathways
|
- Cytosolic DNA-sensing pathway
- Epstein-Barr virus infection
- Huntington disease
- Purine metabolism
- Pyrimidine metabolism
- RNA polymerase
|
Reactions
|
Adenosine triphosphate + RNA → Pyrophosphate + RNA |
details
|
Guanosine triphosphate + RNA → Pyrophosphate + RNA |
details
|
Cytidine triphosphate + RNA → Pyrophosphate + RNA |
details
|
Uridine triphosphate + RNA → Pyrophosphate + RNA |
details
|
|
GO Classification
|
Biological Process |
termination of RNA polymerase III transcription |
transcription elongation from RNA polymerase III promoter |
regulation of transcription from RNA polymerase I promoter |
transcription-coupled nucleotide-excision repair |
7-methylguanosine mRNA capping |
mRNA splicing, via spliceosome |
viral reproduction |
protein phosphorylation |
positive regulation of viral transcription |
transcription elongation from RNA polymerase II promoter |
transcription initiation from RNA polymerase II promoter |
Cellular Component |
DNA-directed RNA polymerase II, core complex |
Molecular Function |
metal ion binding |
zinc ion binding |
DNA-directed RNA polymerase activity |
DNA binding |
|
Cellular Location
|
Not Available
|
Gene Properties |
Chromosome Location
| 11 |
Locus
| 11p15 |
SNPs
| Not Available |
Gene Sequence
|
Not Available
|
Protein Properties |
Number of Residues
| Not Available |
Molecular Weight
| 7645.02 |
Theoretical pI
| 7.771 |
Pfam Domain Function
|
Not Available |
Signals
|
Not Available
|
Transmembrane Regions
|
Not Available
|
Protein Sequence
|
>>gi|10863925|ref|NP_066951.1| DNA-directed RNA polymerases I, II, and III subunit RPABC5 [Homo sapiens]
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLL
NYAPLEK
|
External Links |
GenBank ID Protein
| Not Available |
UniProtKB/Swiss-Prot ID
| P62875 |
UniProtKB/Swiss-Prot Entry Name
| Not Available |
PDB IDs
|
Not Available |
GenBank Gene ID
| Not Available |
GeneCard ID
| Not Available |
GenAtlas ID
| Not Available |
HGNC ID
| HGNC:9199 |
References |
General References
| Not Available |