Hmdb loader
Survey
Identification
HMDB Protein ID HMDBP11916
Secondary Accession Numbers None
Name DNA-directed RNA polymerases I and III subunit RPAC1
Synonyms
  1. DNA-directed RNA polymerase I subunit C
  2. RNA polymerases I and III subunit AC1
  3. AC40
  4. DNA-directed RNA polymerases I and III 40 kDa polypeptide
  5. RPA39
  6. RPC40
  7. RPA40
Gene Name POLR1C
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively. RPAC1 is part of the Pol core element with the central large cleft and probably a clamp element that moves to open and close the cleft (By similarity).
Pathways
  • Cytosolic DNA-sensing pathway
  • Epstein-Barr virus infection
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
termination of RNA polymerase III transcription
transcription elongation from RNA polymerase III promoter
termination of RNA polymerase I transcription
transcription elongation from RNA polymerase I promoter
transcription initiation from RNA polymerase I promoter
Cellular Component
nucleoplasm
DNA-directed RNA polymerase I complex
Molecular Function
DNA-directed RNA polymerase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 39249.375
Theoretical pI 5.504
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|42560246|ref|NP_976035.1| DNA-directed RNA polymerases I and III subunit RPAC1 [Homo sapiens]
MAASQAVEEMRSRVVLGEFGVRNVHTTDFPGNYSGYDDAWDQDRFEKNFRVDVVHMDENS
LEFDMVGIDA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O15160
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20194
References
General References Not Available