Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11917
Secondary Accession Numbers None
Name Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
Synonyms
  1. RNA polymerase II-associated protein 2
Gene Name RPAP2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Protein phosphatase that displays CTD phosphatase activity and regulates transcription of snRNA genes. Recognizes and binds phosphorylated 'Ser-7' of the C-terminal heptapeptide repeat domain (CTD) of the largest RNA polymerase II subunit POLR2A, and mediates dephosphorylation of 'Ser-5' of the CTD, thereby promoting transcription of snRNA genes.
Pathways Not Available
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
dephosphorylation of RNA polymerase II C-terminal domain
snRNA transcription
Cellular Component
DNA-directed RNA polymerase II, holoenzyme
cytoplasm
Molecular Function
metal ion binding
CTD phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 69508.135
Theoretical pI 7.788
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|226246608|ref|NP_079089.2| putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 [Homo sapiens]
MADFAGPSSAGRKAGAPRCSRKAAGTKQTSTLKQEDASKRKAELEAAVRKKIEFERKALH
IVEQLLEENI
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q8IXW5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25791
References
General References Not Available