Showing Protein DNA-directed RNA polymerase II subunit RPB4 (HMDBP11921)
Identification | |||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11921 | ||||||||||||||
Secondary Accession Numbers | None | ||||||||||||||
Name | DNA-directed RNA polymerase II subunit RPB4 | ||||||||||||||
Synonyms |
|
||||||||||||||
Gene Name | POLR2D | ||||||||||||||
Protein Type | Unknown | ||||||||||||||
Biological Properties | |||||||||||||||
General Function | Not Available | ||||||||||||||
Specific Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity). | ||||||||||||||
Pathways |
|
||||||||||||||
Reactions |
|
||||||||||||||
GO Classification |
|
||||||||||||||
Cellular Location | Not Available | ||||||||||||||
Gene Properties | |||||||||||||||
Chromosome Location | 2 | ||||||||||||||
Locus | 2q21 | ||||||||||||||
SNPs | Not Available | ||||||||||||||
Gene Sequence | Not Available | ||||||||||||||
Protein Properties | |||||||||||||||
Number of Residues | Not Available | ||||||||||||||
Molecular Weight | 16311.105 | ||||||||||||||
Theoretical pI | 4.795 | ||||||||||||||
Pfam Domain Function | Not Available | ||||||||||||||
Signals | Not Available | ||||||||||||||
Transmembrane Regions | Not Available | ||||||||||||||
Protein Sequence |
>>gi|4758574|ref|NP_004796.1| DNA-directed RNA polymerase II subunit RPB4 [Homo sapiens] MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV FMKTLNYTAR |
||||||||||||||
External Links | |||||||||||||||
GenBank ID Protein | Not Available | ||||||||||||||
UniProtKB/Swiss-Prot ID | O15514 | ||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||||
PDB IDs | |||||||||||||||
GenBank Gene ID | Not Available | ||||||||||||||
GeneCard ID | Not Available | ||||||||||||||
GenAtlas ID | Not Available | ||||||||||||||
HGNC ID | HGNC:9191 | ||||||||||||||
References | |||||||||||||||
General References | Not Available |