Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11921
Secondary Accession Numbers None
Name DNA-directed RNA polymerase II subunit RPB4
Synonyms
  1. RNA polymerase II subunit B4
  2. DNA-directed RNA polymerase II subunit D
  3. RNA polymerase II 16 kDa subunit
  4. RPB16
Gene Name POLR2D
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RBP4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity).
Pathways
  • Epstein-Barr virus infection
  • Huntington disease
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
viral reproduction
protein phosphorylation
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
DNA-directed RNA polymerase II, core complex
Molecular Function
DNA-directed RNA polymerase activity
nucleotide binding
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 16311.105
Theoretical pI 4.795
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4758574|ref|NP_004796.1| DNA-directed RNA polymerase II subunit RPB4 [Homo sapiens]
MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEV
FMKTLNYTAR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID O15514
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9191
References
General References Not Available