Showing Protein DNA-directed RNA polymerase II subunit RPB9 (HMDBP11923)
Identification | |||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11923 | ||||||||||||||||
Secondary Accession Numbers | None | ||||||||||||||||
Name | DNA-directed RNA polymerase II subunit RPB9 | ||||||||||||||||
Synonyms |
|
||||||||||||||||
Gene Name | POLR2I | ||||||||||||||||
Protein Type | Unknown | ||||||||||||||||
Biological Properties | |||||||||||||||||
General Function | Not Available | ||||||||||||||||
Specific Function | DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template (By similarity). | ||||||||||||||||
Pathways |
|
||||||||||||||||
Reactions |
|
||||||||||||||||
GO Classification |
|
||||||||||||||||
Cellular Location | Not Available | ||||||||||||||||
Gene Properties | |||||||||||||||||
Chromosome Location | 19 | ||||||||||||||||
Locus | 19q12 | ||||||||||||||||
SNPs | Not Available | ||||||||||||||||
Gene Sequence | Not Available | ||||||||||||||||
Protein Properties | |||||||||||||||||
Number of Residues | Not Available | ||||||||||||||||
Molecular Weight | 14523.1 | ||||||||||||||||
Theoretical pI | 5.138 | ||||||||||||||||
Pfam Domain Function | Not Available | ||||||||||||||||
Signals | Not Available | ||||||||||||||||
Transmembrane Regions | Not Available | ||||||||||||||||
Protein Sequence |
>>gi|5453930|ref|NP_006224.1| DNA-directed RNA polymerase II subunit RPB9 [Homo sapiens] MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH EVDELTQIIA |
||||||||||||||||
External Links | |||||||||||||||||
GenBank ID Protein | Not Available | ||||||||||||||||
UniProtKB/Swiss-Prot ID | P36954 | ||||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||||||||
PDB IDs | Not Available | ||||||||||||||||
GenBank Gene ID | Not Available | ||||||||||||||||
GeneCard ID | Not Available | ||||||||||||||||
GenAtlas ID | Not Available | ||||||||||||||||
HGNC ID | HGNC:9196 | ||||||||||||||||
References | |||||||||||||||||
General References | Not Available |