Hmdb loader
Identification
HMDB Protein ID HMDBP11923
Secondary Accession Numbers None
Name DNA-directed RNA polymerase II subunit RPB9
Synonyms
  1. RNA polymerase II subunit B9
  2. DNA-directed RNA polymerase II subunit I
  3. RNA polymerase II 14.5 kDa subunit
  4. RPB14.5
Gene Name POLR2I
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB9 is part of the upper jaw surrounding the central large cleft and thought to grab the incoming DNA template (By similarity).
Pathways
  • Epstein-Barr virus infection
  • Huntington disease
  • Purine metabolism
  • Pyrimidine metabolism
  • RNA polymerase
Reactions
Adenosine triphosphate + RNA → Pyrophosphate + RNA details
Guanosine triphosphate + RNA → Pyrophosphate + RNA details
Cytidine triphosphate + RNA → Pyrophosphate + RNA details
Uridine triphosphate + RNA → Pyrophosphate + RNA details
GO Classification
Biological Process
transcription-coupled nucleotide-excision repair
7-methylguanosine mRNA capping
mRNA splicing, via spliceosome
viral reproduction
protein phosphorylation
positive regulation of viral transcription
transcription elongation from RNA polymerase II promoter
transcription initiation from RNA polymerase II promoter
Cellular Component
DNA-directed RNA polymerase II, core complex
Molecular Function
metal ion binding
zinc ion binding
DNA-directed RNA polymerase activity
DNA binding
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19q12
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 14523.1
Theoretical pI 5.138
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|5453930|ref|NP_006224.1| DNA-directed RNA polymerase II subunit RPB9 [Homo sapiens]
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIA
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P36954
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:9196
References
General References Not Available