Showing Protein tRNA-splicing ligase RtcB homolog (HMDBP11927)
Identification | ||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11927 | |||||||||||
Secondary Accession Numbers | None | |||||||||||
Name | tRNA-splicing ligase RtcB homolog | |||||||||||
Synonyms | Not Available | |||||||||||
Gene Name | C22orf28 | |||||||||||
Protein Type | Unknown | |||||||||||
Biological Properties | ||||||||||||
General Function | Not Available | |||||||||||
Specific Function | Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as a RNA ligase with broad substrate specificity, and may function toward other RNAs. | |||||||||||
Pathways | Not Available | |||||||||||
Reactions |
|
|||||||||||
GO Classification |
|
|||||||||||
Cellular Location | Not Available | |||||||||||
Gene Properties | ||||||||||||
Chromosome Location | 22 | |||||||||||
Locus | 22q12 | |||||||||||
SNPs | Not Available | |||||||||||
Gene Sequence | Not Available | |||||||||||
Protein Properties | ||||||||||||
Number of Residues | Not Available | |||||||||||
Molecular Weight | 55209.95 | |||||||||||
Theoretical pI | 7.218 | |||||||||||
Pfam Domain Function |
|
|||||||||||
Signals | Not Available | |||||||||||
Transmembrane Regions | Not Available | |||||||||||
Protein Sequence |
>>gi|7657015|ref|NP_055121.1| tRNA-splicing ligase RtcB homolog [Homo sapiens] MSRSYNDELQFLEKINKNCWRIKKGFVPNMQVEGVFYVNDALEKLMFEELRNACRGGGVG GFLPAMKQIG |
|||||||||||
External Links | ||||||||||||
GenBank ID Protein | Not Available | |||||||||||
UniProtKB/Swiss-Prot ID | Q9Y3I0 | |||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||
PDB IDs | Not Available | |||||||||||
GenBank Gene ID | Not Available | |||||||||||
GeneCard ID | Not Available | |||||||||||
GenAtlas ID | Not Available | |||||||||||
HGNC ID | HGNC:26935 | |||||||||||
References | ||||||||||||
General References | Not Available |