Showing Protein Sulfate anion transporter 1 (HMDBP11931)
| Identification | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11931 | ||||||||||
| Secondary Accession Numbers | None | ||||||||||
| Name | Sulfate anion transporter 1 | ||||||||||
| Synonyms |
|
||||||||||
| Gene Name | SLC26A1 | ||||||||||
| Protein Type | Unknown | ||||||||||
| Biological Properties | |||||||||||
| General Function | Not Available | ||||||||||
| Specific Function | High affinity uptake of sulfate. Accepts oxalate, but not succinate as a cosubstrate. | ||||||||||
| Pathways | Not Available | ||||||||||
| Reactions | Not Available | ||||||||||
| GO Classification |
|
||||||||||
| Cellular Location | Not Available | ||||||||||
| Gene Properties | |||||||||||
| Chromosome Location | 4 | ||||||||||
| Locus | 4p16.3 | ||||||||||
| SNPs | Not Available | ||||||||||
| Gene Sequence | Not Available | ||||||||||
| Protein Properties | |||||||||||
| Number of Residues | Not Available | ||||||||||
| Molecular Weight | 75014.72 | ||||||||||
| Theoretical pI | 8.104 | ||||||||||
| Pfam Domain Function | Not Available | ||||||||||
| Signals | Not Available | ||||||||||
| Transmembrane Regions | Not Available | ||||||||||
| Protein Sequence |
>>gi|20336272|ref|NP_071325.2| sulfate anion transporter 1 isoform a [Homo sapiens] MDESPEPLQQGRGPVPVRRQRPAPRGLREMLKARLWCSCSCSVLCVRALVQDLLPATRWL RQYRPREYLA |
||||||||||
| External Links | |||||||||||
| GenBank ID Protein | Not Available | ||||||||||
| UniProtKB/Swiss-Prot ID | Q9H2B4 | ||||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
| PDB IDs | Not Available | ||||||||||
| GenBank Gene ID | Not Available | ||||||||||
| GeneCard ID | Not Available | ||||||||||
| GenAtlas ID | Not Available | ||||||||||
| HGNC ID | HGNC:10993 | ||||||||||
| References | |||||||||||
| General References | Not Available | ||||||||||