Showing Protein CMP-sialic acid transporter (HMDBP11932)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11932 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | CMP-sialic acid transporter | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | SLC35A1 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function. | |||||||||
| Pathways | Not Available | |||||||||
| Reactions | Not Available | |||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 6 | |||||||||
| Locus | 6q15 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 29918.335 | |||||||||
| Theoretical pI | 9.061 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|270288773|ref|NP_001161870.1| CMP-sialic acid transporter isoform b [Homo sapiens] MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSV GILAKETGSL |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | P78382 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:11021 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||