You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11932
Secondary Accession Numbers None
Name CMP-sialic acid transporter
Synonyms
  1. CMP-SA-Tr
  2. CMP-Sia-Tr
  3. Solute carrier family 35 member A1
Gene Name SLC35A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Transports CMP-sialic acid from the cytosol into Golgi vesicles where glycosyltransferases function.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
cellular protein modification process
carbohydrate metabolic process
Cellular Component
Golgi membrane
integral to plasma membrane
Molecular Function
CMP-N-acetylneuraminate transmembrane transporter activity
sugar:hydrogen symporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6q15
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 29918.335
Theoretical pI 9.061
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|270288773|ref|NP_001161870.1| CMP-sialic acid transporter isoform b [Homo sapiens]
MAAPRDNVTLLFKLYCLAVMTLMAAVYTIALRYTRTSDKELYFSTTAVCITEVIKLLLSV
GILAKETGSL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P78382
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11021
References
General References Not Available