You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11933
Secondary Accession Numbers None
Name UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter
Synonyms
  1. Homolog of Fringe connection protein 1
  2. SQV7-like protein
  3. Solute carrier family 35 member D2
  4. UDP-galactose transporter-related protein 8
  5. HFRC1
  6. SQV7L
  7. UGTrel8
Gene Name SLC35D2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Antiporter transporting nucleotide sugars such as UDP-N-acetylglucosamine (UDP-GlcNAc), UDP-glucose (UDP-Glc) and GDP-mannose (GDP-Man) pooled in the cytosol into the lumen of the Golgi in exchange for the corresponding nucleosides monophosphates (UMP for UDP-sugars and GMP for GDP-sugars). May take part in heparan sulfate synthesis by supplying UDP-Glc-NAc, the donor substrate, and thus be involved in growth factor signaling.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
carbohydrate transport
Cellular Component
integral to membrane
Golgi membrane
Molecular Function
nucleotide-sugar transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 9
Locus 9q22.32
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 36672.12
Theoretical pI 8.689
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|223029426|ref|NP_008932.2| UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter [Homo sapiens]
MTAGGQAEAEGAGGEPGAARLPSRVARLLSALFYGTCSFLIVLVNKALLTTYGFPSPIFL
GIGQMAATIM
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q76EJ3
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20799
References
General References Not Available