You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11934
Secondary Accession Numbers None
Name Zinc transporter ZIP1
Synonyms
  1. Solute carrier family 39 member 1
  2. Zinc-iron-regulated transporter-like
  3. Zrt- and Irt-like protein 1
  4. ZIP-1
  5. hZIP1
Gene Name SLC39A1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mediates zinc uptake. May function as a major endogenous zinc uptake transporter in many cells of the body. Responsible for the rapid uptake and accumulation of physiologically effective zinc in prostate cells.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transmembrane transport
Cellular Component
endoplasmic reticulum membrane
plasma membrane
integral to membrane
Molecular Function
inorganic cation transmembrane transporter activity
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 34249.215
Theoretical pI 5.922
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|430768587|ref|NP_001258886.1| zinc transporter ZIP1 isoform a [Homo sapiens]
MGPWGEPELLVWRPEAVASEPPVPVGLEVKLGALVLLLVLTLLCSLVPICVLRRPGANHE
GSASRQKALS
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NY26
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:12876
References
General References Not Available