You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11935
Secondary Accession Numbers None
Name Zinc transporter ZIP2
Synonyms
  1. 6A1
  2. Eti-1
  3. Solute carrier family 39 member 2
  4. Zrt- and Irt-like protein 2
  5. ZIP-2
  6. hZIP2
Gene Name SLC39A2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Mediates zinc uptake. Zinc uptake may be mediated by a Zn(2+)-HCO(3)(-) symport mechanism and can function in the presence of albumin. May also transport other divalent cations. May be important in contact inhibition of normal epithelial cells and loss of its expression may play a role in tumorigenesis.
Pathways Not Available
Reactions Not Available
GO Classification
Cellular Component
integral to plasma membrane
cytoplasmic membrane-bounded vesicle
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 32742.03
Theoretical pI 6.294
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|156415986|ref|NP_055394.2| zinc transporter ZIP2 isoform a [Homo sapiens]
MEQLLGIKLGCLFALLALTLGCGLTPICFKWFQIDAARGHHRLVLRLLGCISAGVFLGAG
FMHMTAEALE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NP94
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17127
References
General References Not Available