Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11936
Secondary Accession Numbers None
Name Zinc transporter ZIP3
Synonyms
  1. Solute carrier family 39 member 3
  2. Zrt- and Irt-like protein 3
  3. ZIP-3
Gene Name SLC39A3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a zinc-influx transporter (Potential).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
transmembrane transport
Cellular Component
plasma membrane
integral to membrane
Molecular Function
zinc ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 19
Locus 19p13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 33600.495
Theoretical pI 6.878
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|32490561|ref|NP_653165.2| zinc transporter ZIP3 isoform a [Homo sapiens]
MVKLLVAKILCMVGVFFFMLLGSLLPVKIIETDFEKAHRSKKILSLCNTFGGGVFLATCF
NALLPAVREK
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9BRY0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:17128
References
General References Not Available