Showing Protein Zinc transporter ZIP5 (HMDBP11938)
| Identification | ||||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11938 | |||||||||
| Secondary Accession Numbers | None | |||||||||
| Name | Zinc transporter ZIP5 | |||||||||
| Synonyms |
|
|||||||||
| Gene Name | SLC39A5 | |||||||||
| Protein Type | Unknown | |||||||||
| Biological Properties | ||||||||||
| General Function | Not Available | |||||||||
| Specific Function | May play a role in polarized cells by carrying out serosal-to-mucosal zinc transport. Seems to play a central role in controlling organismal zinc status (By similarity). | |||||||||
| Pathways | Not Available | |||||||||
| Reactions | Not Available | |||||||||
| GO Classification |
|
|||||||||
| Cellular Location | Not Available | |||||||||
| Gene Properties | ||||||||||
| Chromosome Location | 12 | |||||||||
| Locus | 12q13.3 | |||||||||
| SNPs | Not Available | |||||||||
| Gene Sequence | Not Available | |||||||||
| Protein Properties | ||||||||||
| Number of Residues | Not Available | |||||||||
| Molecular Weight | 56460.165 | |||||||||
| Theoretical pI | 6.823 | |||||||||
| Pfam Domain Function | Not Available | |||||||||
| Signals | Not Available | |||||||||
| Transmembrane Regions | Not Available | |||||||||
| Protein Sequence |
>>gi|206597541|ref|NP_001128667.1| zinc transporter ZIP5 precursor [Homo sapiens] MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLAR LLHSLGLGRV |
|||||||||
| External Links | ||||||||||
| GenBank ID Protein | Not Available | |||||||||
| UniProtKB/Swiss-Prot ID | Q6ZMH5 | |||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
| PDB IDs | Not Available | |||||||||
| GenBank Gene ID | Not Available | |||||||||
| GeneCard ID | Not Available | |||||||||
| GenAtlas ID | Not Available | |||||||||
| HGNC ID | HGNC:20502 | |||||||||
| References | ||||||||||
| General References | Not Available | |||||||||