Hmdb loader
Identification
HMDB Protein ID HMDBP11938
Secondary Accession Numbers None
Name Zinc transporter ZIP5
Synonyms
  1. Solute carrier family 39 member 5
  2. Zrt- and Irt-like protein 5
  3. ZIP-5
Gene Name SLC39A5
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May play a role in polarized cells by carrying out serosal-to-mucosal zinc transport. Seems to play a central role in controlling organismal zinc status (By similarity).
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
cellular response to zinc ion starvation
zinc ion transport
transmembrane transport
Cellular Component
basolateral plasma membrane
integral to membrane
Molecular Function
metal ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 12
Locus 12q13.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 56460.165
Theoretical pI 6.823
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|206597541|ref|NP_001128667.1| zinc transporter ZIP5 precursor [Homo sapiens]
MMGSPVSHLLAGFCVWVVLGWVGGSVPNLGPAEQEQNHYLAQLFGLYGENGTLTAGGLAR
LLHSLGLGRV
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q6ZMH5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20502
References
General References Not Available