Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11940
Secondary Accession Numbers None
Name Zinc transporter SLC39A7
Synonyms
  1. Histidine-rich membrane protein Ke4
  2. Really interesting new gene 5 protein
  3. Solute carrier family 39 member 7
Gene Name SLC39A7
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
transmembrane transport
Cellular Component
endoplasmic reticulum membrane
integral to membrane
Molecular Function
metal ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 6
Locus 6p21.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 50117.95
Theoretical pI 6.873
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|117553619|ref|NP_001070984.1| zinc transporter SLC39A7 precursor [Homo sapiens]
MARGLGAPHWVAVGLLTWATLGLLVAGLGGHDDLHDDLQEDFHGHSHRHSHEDFHHGHSH
AHGHGHTHES
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q92504
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:4927
References
General References Not Available