You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Zinc transporter ZIP8 (HMDBP11941)
Identification | ||||||||||
---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11941 | |||||||||
Secondary Accession Numbers | None | |||||||||
Name | Zinc transporter ZIP8 | |||||||||
Synonyms |
|
|||||||||
Gene Name | SLC39A8 | |||||||||
Protein Type | Unknown | |||||||||
Biological Properties | ||||||||||
General Function | Not Available | |||||||||
Specific Function | Acts as a zinc-influx transporter. | |||||||||
Pathways | Not Available | |||||||||
Reactions | Not Available | |||||||||
GO Classification |
|
|||||||||
Cellular Location | Not Available | |||||||||
Gene Properties | ||||||||||
Chromosome Location | 4 | |||||||||
Locus | 4q22-q24 | |||||||||
SNPs | Not Available | |||||||||
Gene Sequence | Not Available | |||||||||
Protein Properties | ||||||||||
Number of Residues | Not Available | |||||||||
Molecular Weight | 49630.175 | |||||||||
Theoretical pI | 6.093 | |||||||||
Pfam Domain Function | Not Available | |||||||||
Signals | Not Available | |||||||||
Transmembrane Regions | Not Available | |||||||||
Protein Sequence |
>>gi|205830403|ref|NP_001128618.1| zinc transporter ZIP8 isoform a precursor [Homo sapiens] MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASR VGVPEPGQLH |
|||||||||
External Links | ||||||||||
GenBank ID Protein | Not Available | |||||||||
UniProtKB/Swiss-Prot ID | Q9C0K1 | |||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||
PDB IDs | Not Available | |||||||||
GenBank Gene ID | Not Available | |||||||||
GeneCard ID | Not Available | |||||||||
GenAtlas ID | Not Available | |||||||||
HGNC ID | HGNC:20862 | |||||||||
References | ||||||||||
General References | Not Available |