Hmdb loader
Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11941
Secondary Accession Numbers None
Name Zinc transporter ZIP8
Synonyms
  1. BCG-induced integral membrane protein in monocyte clone 103 protein
  2. LIV-1 subfamily of ZIP zinc transporter 6
  3. Solute carrier family 39 member 8
  4. Zrt- and Irt-like protein 8
  5. LZT-Hs6
  6. ZIP-8
Gene Name SLC39A8
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Acts as a zinc-influx transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
transmembrane transport
Cellular Component
plasma membrane
organelle membrane
integral to membrane
Molecular Function
metal ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q22-q24
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49630.175
Theoretical pI 6.093
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|205830403|ref|NP_001128618.1| zinc transporter ZIP8 isoform a precursor [Homo sapiens]
MAPGRAVAGLLLLAAAGLGGVAEGPGLAFSEDVLSVFGANLSLSAAQLQHLLEQMGAASR
VGVPEPGQLH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9C0K1
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20862
References
General References Not Available