Hmdb loader
Survey
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11943
Secondary Accession Numbers None
Name Zinc transporter ZIP10
Synonyms
  1. Solute carrier family 39 member 10
  2. Zrt- and Irt-like protein 10
  3. ZIP-10
Gene Name SLC39A10
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May act as a zinc-influx transporter.
Pathways Not Available
Reactions Not Available
GO Classification
Biological Process
zinc ion transport
transmembrane transport
Cellular Component
integral to membrane
Molecular Function
metal ion transmembrane transporter activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q32.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 94131.47
Theoretical pI 6.753
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|187936949|ref|NP_001120729.1| zinc transporter ZIP10 precursor [Homo sapiens]
MKVHMHTKFCLICLLTFIFHHCNHCHEEHDHGPEALHRQHRGMTELEPSKFSKQAAENEK
KYYIEKLFER
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9ULF5
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20861
References
General References Not Available