You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Showing Protein Zinc transporter ZIP13 (HMDBP11946)
| Identification | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| HMDB Protein ID | HMDBP11946 | ||||||||
| Secondary Accession Numbers | None | ||||||||
| Name | Zinc transporter ZIP13 | ||||||||
| Synonyms |
|
||||||||
| Gene Name | SLC39A13 | ||||||||
| Protein Type | Unknown | ||||||||
| Biological Properties | |||||||||
| General Function | Not Available | ||||||||
| Specific Function | Acts as a zinc-influx transporter. | ||||||||
| Pathways | Not Available | ||||||||
| Reactions | Not Available | ||||||||
| GO Classification |
|
||||||||
| Cellular Location | Not Available | ||||||||
| Gene Properties | |||||||||
| Chromosome Location | 11 | ||||||||
| Locus | 11p11.2 | ||||||||
| SNPs | Not Available | ||||||||
| Gene Sequence | Not Available | ||||||||
| Protein Properties | |||||||||
| Number of Residues | Not Available | ||||||||
| Molecular Weight | 38938.04 | ||||||||
| Theoretical pI | 5.443 | ||||||||
| Pfam Domain Function | Not Available | ||||||||
| Signals | Not Available | ||||||||
| Transmembrane Regions | Not Available | ||||||||
| Protein Sequence |
>>gi|190014617|ref|NP_001121697.1| zinc transporter ZIP13 isoform a precursor [Homo sapiens] MPGCPCPGCGMAGPRLLFLTALALELLGRAGGSQPALRSRGTATACRLDNKESESWGALL SGERLDTWIC |
||||||||
| External Links | |||||||||
| GenBank ID Protein | Not Available | ||||||||
| UniProtKB/Swiss-Prot ID | Q96H72 | ||||||||
| UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||
| PDB IDs | Not Available | ||||||||
| GenBank Gene ID | Not Available | ||||||||
| GeneCard ID | Not Available | ||||||||
| GenAtlas ID | Not Available | ||||||||
| HGNC ID | HGNC:20859 | ||||||||
| References | |||||||||
| General References | Not Available | ||||||||