| Identification |
|---|
| HMDB Protein ID
| HMDBP11948 |
| Secondary Accession Numbers
| None |
| Name
| Solute carrier family 52, riboflavin transporter, member 3 |
| Synonyms
|
- Riboflavin transporter 2
- hRFT2
|
| Gene Name
| SLC52A3 |
| Protein Type
| Unknown |
| Biological Properties |
|---|
| General Function
| Not Available |
| Specific Function
| Riboflavin transporter. Riboflavin transport is Na(+)-independent but moderately pH-sensitive. Activity is strongly inhibited by riboflavin analogs, such as lumiflavin, flavin mononucleotide (FMN) and flavin adenine dinucleotide (FAD), and to a lesser extent by amiloride.
|
| Pathways
|
- Vitamin digestion and absorption
|
| Reactions
| Not Available |
| GO Classification
|
| Biological Process |
| sensory perception of sound |
| cellular response to heat |
| Cellular Component |
| integral to plasma membrane |
| Molecular Function |
| riboflavin transporter activity |
|
| Cellular Location
|
Not Available
|
| Gene Properties |
|---|
| Chromosome Location
| 20 |
| Locus
| 20p13 |
| SNPs
| Not Available |
| Gene Sequence
|
Not Available
|
| Protein Properties |
|---|
| Number of Residues
| Not Available |
| Molecular Weight
| 50804.56 |
| Theoretical pI
| 5.794 |
| Pfam Domain Function
|
Not Available |
| Signals
|
Not Available
|
|
Transmembrane Regions
|
Not Available
|
| Protein Sequence
|
>>gi|156564359|ref|NP_212134.3| solute carrier family 52, riboflavin transporter, member 3 [Homo sapiens]
MAFLMHLLVCVFGMGSWVTINGLWVELPLLVMELPEGWYLPSYLTVVIQLANIGPLLVTL
LHHFRPSCLS
|
| External Links |
|---|
| GenBank ID Protein
| Not Available |
| UniProtKB/Swiss-Prot ID
| Q9NQ40 |
| UniProtKB/Swiss-Prot Entry Name
| Not Available |
| PDB IDs
|
Not Available |
| GenBank Gene ID
| Not Available |
| GeneCard ID
| Not Available |
| GenAtlas ID
| Not Available |
| HGNC ID
| HGNC:16187 |
| References |
|---|
| General References
| Not Available |
