Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11950
Secondary Accession Numbers None
Name Histone-lysine N-methyltransferase setd3
Synonyms
  1. SET domain-containing protein 3
Gene Name SETD3
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Histone methyltransferase that methylates 'Lys-36' of histone H3 (H3K36me). H3 'Lys-36' methylation represents a specific tag for epigenetic transcriptional activation (By similarity).
Pathways Not Available
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
GO Classification
Biological Process
peptidyl-lysine dimethylation
peptidyl-lysine monomethylation
positive regulation of transcription, DNA-dependent
peptidyl-lysine trimethylation
transcription, DNA-dependent
Cellular Component
nucleus
Molecular Function
transcription coactivator activity
histone methyltransferase activity (H3-K36 specific)
Cellular Location Not Available
Gene Properties
Chromosome Location 14
Locus 14q32.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 67256.535
Theoretical pI 5.961
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|40068481|ref|NP_115609.2| histone-lysine N-methyltransferase setd3 isoform a [Homo sapiens]
MGKKSRVKTQKSGTGATATVSPKEILNLTSELLQKCSSPAPGPGKEWEEYVQIRTLVEKI
RKKQKGLSVT
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q86TU7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20493
References
General References Not Available