You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11952
Secondary Accession Numbers None
Name CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2
Synonyms
  1. Alpha 2,3-ST 2
  2. Beta-galactoside alpha-2,3-sialyltransferase 2
  3. Gal-NAc6S
  4. Gal-beta-1,3-GalNAc-alpha-2,3-sialyltransferase
  5. ST3Gal II
  6. ST3GalA.2
  7. Sialyltransferase 4B
  8. ST3GalII
  9. SIAT4-B
Gene Name ST3GAL2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function It may be responsible for the synthesis of the sequence NeuAc-alpha-2,3-Gal-beta-1,3-GalNAc- found in terminal carbohydrate groups of certain glycoproteins, oligosaccharides and glycolipids. SIAT4A and SIAT4B sialylate the same acceptor substrates but exhibit different Km values.
Pathways
  • Glycosaminoglycan biosynthesis - keratan sulfate
  • Glycosphingolipid biosynthesis - ganglio series
  • Glycosphingolipid biosynthesis - globo series
  • Mucin type O-Glycan biosynthesis
  • protein glycosylation
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + beta-D-galactosyl-1,3-N-acetyl-alpha-D-galactosaminyl-R → Cytidine monophosphate + alpha-N-acetylneuraminyl-2,3-beta-D-galactosyl-1,3-N-acetyl-alpha-D-galactosaminyl-R details
CMP-N-acetylneuraminate + T antigen → CMP + details
CMP-N-acetylneuraminate + GM1 → CMP + GD1a details
CMP-N-acetylneuraminate + GD1b → CMP + GT1b details
CMP-N-acetylneuraminate + GA1 → CMP + GM1b details
CMP-N-acetylneuraminate + Galactosylgloboside → CMP + Monosialylgalactosylgloboside details
GO Classification
Biological Process
keratan sulfate biosynthetic process
O-glycan processing
post-translational protein modification
amino sugar metabolic process
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
extracellular region
Golgi membrane
Molecular Function
beta-galactoside (CMP) alpha-2,3-sialyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 16
Locus 16q22.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 40172.565
Theoretical pI 8.351
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|5902082|ref|NP_008858.1| CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 2 [Homo sapiens]
MKCSLRVWFLSVAFLLVFIMSLLFTYSHHSMATLPYLDSGALDGTHRVKLVPGYAGLQRL
SKERLSGKSC
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q16842
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10863
References
General References Not Available