You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11954
Secondary Accession Numbers None
Name Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2
Synonyms
  1. GalNAc alpha-2,6-sialyltransferase II
  2. ST6GalNAc II
  3. SThM
  4. Sialyltransferase 7B
  5. ST6GalNAcII
  6. SIAT7-B
Gene Name ST6GALNAC2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Not Available
Pathways
  • protein glycosylation
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + glycano-beta-D-galactosyl-1,3-(N-acetyl-D-galactosaminyl)-glycoprotein → Cytidine monophosphate + glycano-beta-D-galactosyl-(2,6-alpha-N-acetylneuraminyl)-(N-acetyl-D-galactosaminyl)-glycoprotein details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
Cellular Component
integral to Golgi membrane
Golgi membrane
Molecular Function
sialyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 17
Locus 17q25.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 41938.815
Theoretical pI 9.318
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|192448440|ref|NP_006447.2| alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 2 precursor [Homo sapiens]
MGLPRGSFFWLLLLLTAACSGLLFALYFSAVQRYPGPAAGARDTTSFEAFFQSKASNSWT
GKGQACRHLL
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UJ37
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10867
References
General References Not Available