You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11956
Secondary Accession Numbers None
Name Beta-galactoside alpha-2,6-sialyltransferase 1
Synonyms
  1. Alpha 2,6-ST 1
  2. B-cell antigen CD75
  3. CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1
  4. ST6Gal I
  5. Sialyltransferase 1
  6. ST6GalI
Gene Name ST6GAL1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates.
Pathways
  • N-Glycan biosynthesis
  • Other types of O-glycan biosynthesis
  • protein glycosylation
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine → Cytidine monophosphate + (N-acetylneuraminosyl(a2-6)lactosamine) details
CMP-N-acetylneuraminate + → CMP + DS 3 details
CMP-N-acetylneuraminate + → CMP + details
GO Classification
Biological Process
O-glycan processing
post-translational protein modification
protein N-linked glycosylation via asparagine
humoral immune response
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
extracellular region
Golgi membrane
Molecular Function
sialyltransferase activity
beta-galactoside alpha-2,6-sialyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 3
Locus 3q27-q28
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 46604.235
Theoretical pI 9.006
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|4506949|ref|NP_003023.1| beta-galactoside alpha-2,6-sialyltransferase 1 isoform a [Homo sapiens]
MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDS
QSVSSSSTQD
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P15907
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10860
References
General References Not Available