Hmdb loader

Showing Protein Beta-galactoside alpha-2,6-sialyltransferase 2 (HMDBP11957)

IdentificationBiological propertiesGene propertiesProtein propertiesExternal linksReferencesXMLShow 3 metabolites
Identification
HMDB Protein ID HMDBP11957
Secondary Accession Numbers None
Name Beta-galactoside alpha-2,6-sialyltransferase 2
Synonyms
  1. Alpha 2,6-ST 2
  2. CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 2
  3. ST6Gal II
  4. Sialyltransferase 2
  5. ST6GalII
  6. hST6Gal II
Gene Name ST6GAL2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Transfers sialic acid from the donor of substrate CMP-sialic acid to galactose containing acceptor substrates. Has alpha-2,6-sialyltransferase activity toward oligosaccharides that have the Gal-beta-1,4-GlcNAc sequence at the non-reducing end of their carbohydrate groups, but it has weak or no activities toward glycoproteins and glycolipids.
Pathways
  • N-Glycan biosynthesis
  • Other types of O-glycan biosynthesis
Reactions
Cytidine 5'-monophosphate-N-acetylneuraminic acid + beta-D-galactosyl-1,4-N-acetyl-beta-D-glucosamine → Cytidine monophosphate + (N-acetylneuraminosyl(a2-6)lactosamine) details
CMP-N-acetylneuraminate + → CMP + details
GO Classification
Biological Process
multicellular organismal development
protein glycosylation
oligosaccharide metabolic process
growth
Cellular Component
Golgi cisterna membrane
integral to Golgi membrane
integral to membrane
Molecular Function
beta-galactoside alpha-2,6-sialyltransferase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2q11.2-q12.1
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 60157.39
Theoretical pI 9.747
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence 
>>gi|215272345|ref|NP_001135823.1| beta-galactoside alpha-2,6-sialyltransferase 2 isoform a [Homo sapiens]
MKPHLKQWRQRMLFGIFAWGLLFLLIFIYFTDSNPAEPVPSSLSFLETRRLLPVQGKQRA
IMGAAHEPSP
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q96JF0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:10861
References
General References Not Available