Showing Protein Superkiller viralicidic activity 2-like 2 (HMDBP11958)
Identification | |||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11958 | ||||||||||
Secondary Accession Numbers | None | ||||||||||
Name | Superkiller viralicidic activity 2-like 2 | ||||||||||
Synonyms |
|
||||||||||
Gene Name | SKIV2L2 | ||||||||||
Protein Type | Unknown | ||||||||||
Biological Properties | |||||||||||
General Function | Not Available | ||||||||||
Specific Function | May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. | ||||||||||
Pathways |
|
||||||||||
Reactions |
|
||||||||||
GO Classification |
|
||||||||||
Cellular Location | Not Available | ||||||||||
Gene Properties | |||||||||||
Chromosome Location | 5 | ||||||||||
Locus | 5q11.2 | ||||||||||
SNPs | Not Available | ||||||||||
Gene Sequence | Not Available | ||||||||||
Protein Properties | |||||||||||
Number of Residues | Not Available | ||||||||||
Molecular Weight | 117803.765 | ||||||||||
Theoretical pI | 6.529 | ||||||||||
Pfam Domain Function | |||||||||||
Signals | Not Available | ||||||||||
Transmembrane Regions | Not Available | ||||||||||
Protein Sequence |
>>gi|193211480|ref|NP_056175.3| superkiller viralicidic activity 2-like 2 [Homo sapiens] MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG KNKRDVDFEG |
||||||||||
External Links | |||||||||||
GenBank ID Protein | Not Available | ||||||||||
UniProtKB/Swiss-Prot ID | P42285 | ||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | ||||||||||
PDB IDs | Not Available | ||||||||||
GenBank Gene ID | Not Available | ||||||||||
GeneCard ID | Not Available | ||||||||||
GenAtlas ID | Not Available | ||||||||||
HGNC ID | HGNC:18734 | ||||||||||
References | |||||||||||
General References | Not Available |