Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11958
Secondary Accession Numbers None
Name Superkiller viralicidic activity 2-like 2
Synonyms
  1. ATP-dependent helicase SKIV2L2
Gene Name SKIV2L2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA.
Pathways
  • RNA degradation
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
maturation of 5.8S rRNA
mRNA splicing, via spliceosome
Cellular Component
nucleolus
catalytic step 2 spliceosome
Molecular Function
nucleic acid binding
ATP binding
ATP-dependent helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 5
Locus 5q11.2
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 117803.765
Theoretical pI 6.529
Pfam Domain Function
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|193211480|ref|NP_056175.3| superkiller viralicidic activity 2-like 2 [Homo sapiens]
MADAFGDELFSVFEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNG
KNKRDVDFEG
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID P42285
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18734
References
General References Not Available