Hmdb loader
Identification
HMDB Protein ID HMDBP11960
Secondary Accession Numbers None
Name SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1
Synonyms
  1. ATP-dependent helicase 1
  2. hHEL1
Gene Name SMARCAD1
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs. Required for the restoration of heterochromatin organization after replication. Acts at replication sites to facilitate the maintenance of heterochromatin by directing H3 and H4 histones deacetylation, H3 'Lys-9' trimethylation (H3K9me3) and restoration of silencing.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
histone H3 deacetylation
chromosome separation
histone H4 deacetylation
regulation of DNA recombination
nucleotide metabolic process
DNA double-strand break processing
positive regulation of transcription, DNA-dependent
protein homooligomerization
ATP-dependent chromatin remodeling
Cellular Component
heterochromatin
nuclear replication fork
site of double-strand break
nuclear matrix
Molecular Function
ATP binding
DNA binding
helicase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 4
Locus 4q22-q23
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 117601.555
Theoretical pI 5.556
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|190358532|ref|NP_001121901.1| SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 isoform a [Homo sapiens]
MNLFNLDRFRFEKRNKIEEAPEATPQPSQPGPSSPISLSAEEENAEGEVSRANTPDSDIT
EKTEDSSVPE
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9H4L7
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs Not Available
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:18398
References
General References Not Available