Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11961
Secondary Accession Numbers None
Name N-lysine methyltransferase SMYD2
Synonyms
  1. HSKM-B
  2. Histone methyltransferase SMYD2
  3. Lysine N-methyltransferase 3C
  4. SET and MYND domain-containing protein 2
Gene Name SMYD2
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB.
Pathways Not Available
Reactions
S-Adenosylmethionine + L-lysine-[histone] → S-Adenosylhomocysteine + N(6)-methyl-L-lysine-[histone] details
GO Classification
Biological Process
peptidyl-lysine dimethylation
peptidyl-lysine monomethylation
negative regulation of transcription from RNA polymerase II promoter
regulation of DNA damage response, signal transduction by p53 class mediator
negative regulation of cell proliferation
transcription, DNA-dependent
Cellular Component
cytosol
nucleus
Molecular Function
RNA polymerase II core binding
metal ion binding
zinc ion binding
histone methyltransferase activity (H3-K36 specific)
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1q32.3
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 49687.65
Theoretical pI 6.716
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|188035871|ref|NP_064582.2| N-lysine methyltransferase SMYD2 [Homo sapiens]
MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE
GLSKCGRCKQ
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NRG4
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:20982
References
General References Not Available