Showing Protein N-lysine methyltransferase SMYD2 (HMDBP11961)
Identification | ||||||||||||||||
---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
HMDB Protein ID | HMDBP11961 | |||||||||||||||
Secondary Accession Numbers | None | |||||||||||||||
Name | N-lysine methyltransferase SMYD2 | |||||||||||||||
Synonyms |
|
|||||||||||||||
Gene Name | SMYD2 | |||||||||||||||
Protein Type | Unknown | |||||||||||||||
Biological Properties | ||||||||||||||||
General Function | Not Available | |||||||||||||||
Specific Function | Protein-lysine N-methyltransferase that methylates both histones and non-histone proteins. Specifically methylates histone H3 'Lys-4' (H3K4me) and dimethylates histone H3 'Lys-36' (H3K36me2). Has also methyltransferase activity toward non-histone proteins such as p53/TP53 and RB1. Monomethylates 'Lys-370' of p53/TP53, leading to decreased DNA-binding activity and subsequent transcriptional regulation activity of p53/TP53. Monomethylates 'Lys-860' of RB1/RB. | |||||||||||||||
Pathways | Not Available | |||||||||||||||
Reactions |
|
|||||||||||||||
GO Classification |
|
|||||||||||||||
Cellular Location | Not Available | |||||||||||||||
Gene Properties | ||||||||||||||||
Chromosome Location | 1 | |||||||||||||||
Locus | 1q32.3 | |||||||||||||||
SNPs | Not Available | |||||||||||||||
Gene Sequence | Not Available | |||||||||||||||
Protein Properties | ||||||||||||||||
Number of Residues | Not Available | |||||||||||||||
Molecular Weight | 49687.65 | |||||||||||||||
Theoretical pI | 6.716 | |||||||||||||||
Pfam Domain Function | Not Available | |||||||||||||||
Signals | Not Available | |||||||||||||||
Transmembrane Regions | Not Available | |||||||||||||||
Protein Sequence |
>>gi|188035871|ref|NP_064582.2| N-lysine methyltransferase SMYD2 [Homo sapiens] MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKE GLSKCGRCKQ |
|||||||||||||||
External Links | ||||||||||||||||
GenBank ID Protein | Not Available | |||||||||||||||
UniProtKB/Swiss-Prot ID | Q9NRG4 | |||||||||||||||
UniProtKB/Swiss-Prot Entry Name | Not Available | |||||||||||||||
PDB IDs | ||||||||||||||||
GenBank Gene ID | Not Available | |||||||||||||||
GeneCard ID | Not Available | |||||||||||||||
GenAtlas ID | Not Available | |||||||||||||||
HGNC ID | HGNC:20982 | |||||||||||||||
References | ||||||||||||||||
General References | Not Available |