Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11962
Secondary Accession Numbers None
Name Spastin
Synonyms
  1. Spastic paraplegia 4 protein
Gene Name SPAST
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function ATP-dependent microtubule severing protein. Microtubule severing may promote reorganization of cellular microtubule arrays and the release of microtubules from the centrosome following nucleation. Required for membrane traffic from the endoplasmic reticulum (ER) to the Golgi and for completion of the abscission stage of cytokinesis. May also play a role in axon growth and the formation of axonal branches.
Pathways Not Available
Reactions
Adenosine triphosphate + Water → ADP + Phosphate details
GO Classification
Biological Process
cell cycle
microtubule bundle formation
microtubule severing
cytokinesis, completion of separation
ER to Golgi vesicle-mediated transport
nervous system development
protein homooligomerization
cell differentiation
protein hexamerization
cell death
Cellular Component
spindle
endoplasmic reticulum
perinuclear region of cytoplasm
nucleus
microtubule organizing center
cytoplasmic vesicle
microtubule
integral to membrane
endosome
Molecular Function
ATP binding
microtubule binding
microtubule-severing ATPase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 2
Locus 2p24-p21
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 67196.545
Theoretical pI 9.648
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|11875211|ref|NP_055761.2| spastin isoform 1 [Homo sapiens]
MNSPGGRGKKKGSGGASNPVPPRPPPPCLAPAPPAAGPAPPPESPHKRNLYYFSYPLFVG
FALLRLVAFH
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9UBP0
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:11233
References
General References Not Available