Hmdb loader
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Human Metabolome Database.
Identification
HMDB Protein ID HMDBP11964
Secondary Accession Numbers None
Name RNA polymerase II subunit A C-terminal domain phosphatase SSU72
Synonyms
  1. CTD phosphatase SSU72
Gene Name SSU72
Protein Type Unknown
Biological Properties
General Function Not Available
Specific Function Protein phosphatase that catalyzes the dephosphorylation of the C-terminal domain of RNA polymerase II. Plays a role in RNA processing and termination. Plays a role in pre-mRNA polyadenylation via its interaction with SYMPK.
Pathways
  • mRNA surveillance pathway
Reactions
A phosphoprotein + Water → a protein + Phosphate details
GO Classification
Biological Process
dephosphorylation of RNA polymerase II C-terminal domain
mRNA polyadenylation
Cellular Component
cytoplasm
nucleus
Molecular Function
CTD phosphatase activity
Cellular Location Not Available
Gene Properties
Chromosome Location 1
Locus 1p36.33
SNPs Not Available
Gene Sequence Not Available
Protein Properties
Number of Residues Not Available
Molecular Weight 22574.305
Theoretical pI 5.32
Pfam Domain Function Not Available
Signals Not Available
Transmembrane Regions Not Available
Protein Sequence
>>gi|7661832|ref|NP_054907.1| RNA polymerase II subunit A C-terminal domain phosphatase SSU72 [Homo sapiens]
MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTT
YDQMYNDLLR
GenBank ID Protein Not Available
UniProtKB/Swiss-Prot ID Q9NP77
UniProtKB/Swiss-Prot Entry Name Not Available
PDB IDs
GenBank Gene ID Not Available
GeneCard ID Not Available
GenAtlas ID Not Available
HGNC ID HGNC:25016
References
General References Not Available